PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G56160.1
Common NameATMYB72, F14G9.22, MYB72, T6H22.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 296aa    MW: 34106.6 Da    PI: 5.9187
Description myb domain protein 72
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G56160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed+ l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
      AT1G56160.1 16 RGPWSPQEDLTLITFIQKHGHQNWRSLPKLAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding46.77.2e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++ E++ ++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
      AT1G56160.1  69 RGNFSKKEEDAIIHYHQTLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23766IPR009057Homeodomain-like
PROSITE profilePS5129415.9761163IPR017930Myb domain
SuperFamilySSF466895.5E-2914110IPR009057Homeodomain-like
SMARTSM007171.8E-121565IPR001005SANT/Myb domain
PfamPF002494.9E-151663IPR001005SANT/Myb domain
CDDcd001672.61E-91863No hitNo description
PROSITE profilePS5129423.04764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2567118IPR009057Homeodomain-like
SMARTSM007171.8E-1368116IPR001005SANT/Myb domain
PfamPF002497.6E-1469114IPR001005SANT/Myb domain
CDDcd001672.34E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009866Biological Processinduced systemic resistance, ethylene mediated signaling pathway
GO:0030154Biological Processcell differentiation
GO:0071281Biological Processcellular response to iron ion
GO:0071732Biological Processcellular response to nitric oxide
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009046anatomyflower
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGKGRAPCCD KNKVKRGPWS PQEDLTLITF IQKHGHQNWR SLPKLAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFSKKEEDAI IHYHQTLGNK WSKIASFLPG RTDNEIKNVW NTHLKKRLTP  120
SSSSSSLSST HDQSTKADHD KNCDGAQEEI HSGLNESQNS ATSSHHQGEC MHTKPELHEV  180
NGLNEIQFLL DHDDFDDITS EFLQDNDILF PLDSLLHNHQ THISTQEMTR EVTKSQSFDH  240
PQPDIPCGFE DTNEESDLRR QLVESTTPNN EYDEWFNFID NQTYFDDFNF VGEVCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26161187108B-MYB
1gv2_A7e-26161184105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184057110.0
Genevisible262091_at0.0
Expression AtlasAT1G56160-
AtGenExpressAT1G56160-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the R2R3 transcription factor gene family that is involved in mediating induced systemic resistance. Genetic analysis of loss of function mutants and overexpressor lines indicates MYB72 is necessary but not sufficient for ISR.Interacts in vivo with EIL3.
Function -- GeneRIF ? help Back to Top
  1. induced systemic resistance (ISR) signaling component that is required in the roots during early signaling steps of rhizobacteria-mediated ISR
    [PMID: 18218967]
  2. MYB72 functions as an early node of convergence in the signalling pathways that are induced by different beneficial microorganisms
    [PMID: 19121118]
  3. our results provide evidence that MYB10 and MYB72 act early in the iron-deficiency regulatory cascade to drive gene expression of NAS4 and are essential for plant survival under iron deficiency
    [PMID: 24278034]
  4. MYB72 regulates the expression of genes associated with the production of iron mobilizing phenolic metabolites, and that BGLU42 plays an important role in the secretion of these compounds in the root vicinity.
    [PMID: 25138267]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G56160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDethylene
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G73730
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G56160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0629050.0AF062905.1 Arabidopsis thaliana putative transcription factor (MYB72) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176012.10.0R2R3 transcription factor MYB72
TrEMBLQ9SGU30.0Q9SGU3_ARATH; Myb domain protein 72
STRINGAT1G56160.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Zhang S, et al.
    Resources for targeted insertional and deletional mutagenesis in Arabidopsis.
    Plant Mol. Biol., 2003. 53(1-2): p. 133-50
    [PMID:14756312]
  5. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  6. Colangelo EP,Guerinot ML
    The essential basic helix-loop-helix protein FIT1 is required for the iron deficiency response.
    Plant Cell, 2004. 16(12): p. 3400-12
    [PMID:15539473]
  7. van de Mortel JE, et al.
    Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens.
    Plant Physiol., 2006. 142(3): p. 1127-47
    [PMID:16998091]
  8. Van der Ent S, et al.
    MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1293-304
    [PMID:18218967]
  9. Yang TJ,Perry PJ,Ciani S,Pandian S,Schmidt W
    Manganese deficiency alters the patterning and development of root hairs in Arabidopsis.
    J. Exp. Bot., 2008. 59(12): p. 3453-64
    [PMID:18772308]
  10. Segarra G,Van der Ent S,Trillas I,Pieterse CM
    MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe.
    Plant Biol (Stuttg), 2009. 11(1): p. 90-6
    [PMID:19121118]
  11. Garc
    Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis.
    J. Exp. Bot., 2010. 61(14): p. 3885-99
    [PMID:20627899]
  12. Palmer CM,Hindt MN,Schmidt H,Clemens S,Guerinot ML
    MYB10 and MYB72 are required for growth under iron-limiting conditions.
    PLoS Genet., 2013. 9(11): p. e1003953
    [PMID:24278034]
  13. Zamioudis C,Hanson J,Pieterse CM
    β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots.
    New Phytol., 2014. 204(2): p. 368-79
    [PMID:25138267]
  14. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]